General Information of Drug Off-Target (DOT) (ID: OT06IH3H)

DOT Name FXYD domain-containing ion transport regulator 4 (FXYD4)
Gene Name FXYD4
Related Disease
Candidemia ( )
Candidiasis, invasive ( )
Invasive candidiasis ( )
UniProt ID
FXYD4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02038
Sequence
MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGK
CKCKSSQKQHSPVPEKAIPLITPGSATTC
KEGG Pathway
Aldosterone-regulated sodium reabsorption (hsa04960 )
Reactome Pathway
Ion transport by P-type ATPases (R-HSA-936837 )
Potential therapeutics for SARS (R-HSA-9679191 )
Ion homeostasis (R-HSA-5578775 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Candidemia DISVKFN7 Strong Biomarker [1]
Candidiasis, invasive DIS5VDG3 Strong Biomarker [2]
Invasive candidiasis DIS5EI0L Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of FXYD domain-containing ion transport regulator 4 (FXYD4). [3]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of FXYD domain-containing ion transport regulator 4 (FXYD4). [4]
Progesterone DMUY35B Approved Progesterone decreases the expression of FXYD domain-containing ion transport regulator 4 (FXYD4). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of FXYD domain-containing ion transport regulator 4 (FXYD4). [6]
------------------------------------------------------------------------------------

References

1 Development of fluconazole resistance in a series of Candida parapsilosis isolates from a persistent candidemia patient with prolonged antifungal therapy.BMC Infect Dis. 2015 Aug 18;15:340. doi: 10.1186/s12879-015-1086-6.
2 Five-Year National Surveillance of Invasive Candidiasis: Species Distribution and Azole Susceptibility from the China Hospital Invasive Fungal Surveillance Net (CHIF-NET) Study.J Clin Microbiol. 2018 Jun 25;56(7):e00577-18. doi: 10.1128/JCM.00577-18. Print 2018 Jul.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
5 Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.