Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT06IH3H)
DOT Name | FXYD domain-containing ion transport regulator 4 (FXYD4) | ||||
---|---|---|---|---|---|
Gene Name | FXYD4 | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGK
CKCKSSQKQHSPVPEKAIPLITPGSATTC |
||||
KEGG Pathway | |||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
3 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||
References