Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0BQQU9)

DOT Name	Putative cyclin-dependent kinase inhibitor 1A (cdkn1a)
Synonyms	P21/WAF1/CIP1
Gene Name	cdkn1a
UniProt ID	Q683K8_CANLF
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02234
Sequence	DCDALMASCVQEARERWNFDFVTETPLEGDFAWERVRGLGLSKVSLPAGPRGGRDDLGGG KRPGTSPALLQGTAQEDHLDLSLTCTLLPHSPERPEASPGVPGTSQGRKRRQTSMTDFYH SKRRLIFSKRKP

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cidofovir	DMA13GD	Approved	Putative cyclin-dependent kinase inhibitor 1A (cdkn1a) increases the Apoptosis ADR of Cidofovir.	[1]
------------------------------------------------------------------------------------

References

1	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.