Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT0BVQRB)
| DOT Name | Regenerating islet-derived protein 3-alpha (REG3A) | ||||
|---|---|---|---|---|---|
| Synonyms | REG-3-alpha; Hepatointestinal pancreatic protein; HIP/PAP; Human proislet peptide; HIP; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-alpha; Reg III-alpha | ||||
| Gene Name | REG3A | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence |
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKS
WTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGW EWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD |
||||
| Function |
[Regenerating islet-derived protein 3-alpha 15 kDa form]: Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Binds membrane phospholipids and kills bacteria by forming a hexameric membrane-permeabilizing oligomeric pore ; Acts as a hormone in response to different stimuli like anti-inflammatory signals, such as IL17A, or gut microbiome. Secreted by different cell types to activate its receptor EXTL3 and induce cell specific signaling pathways. Induced by IL17A in keratinocytes, regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway. In parallel, inhibits skin inflammation through the inhibition of inflammatory cytokines such as IL6 and TNF. In pancreas, is able to permealize beta-cells membrane and stimulate their proliferation ; [Regenerating islet-derived protein 3-alpha 16.5 kDa form]: Has bacteriostatic activity.
|
||||
| Tissue Specificity |
Expressed by keratinocytes . Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level) . Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis .
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
References
