Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0DJDP6)

DOT Name	Cystatin-11 (CST11)
Gene Name	CST11
Related Disease	Advanced cancer ( )
UniProt ID	CST11_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00031
Sequence	MMAEPWQALQLLLAILLTLMALPYQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESD DKYHFRIFRVLKVQRQVTDHLEYHLNVEMQWTTCQKPETTNCVPQERELHKQVNCFFSVF AVPWFEQYKILNKSCSSD
Function	Has antibacterial activity against the Gram-negative bacteria E.coli. May play a role in sperm maturation and fertilization.
Tissue Specificity	Detected in the epithelium and lumen of the epididymis, and in sperm (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Advanced cancer	DISAT1Z9	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cystatin-11 (CST11).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cystatin-11 (CST11).	[3]
------------------------------------------------------------------------------------

References

1	Targeting DNA Flap Endonuclease 1 to Impede Breast Cancer Progression.EBioMedicine. 2016 Dec;14:32-43. doi: 10.1016/j.ebiom.2016.11.012. Epub 2016 Nov 10.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.