Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0JNP52)

DOT Name Putative tyrosine-protein phosphatase TPTE (TPTE)
Synonyms EC 3.1.3.48; Cancer/testis antigen 44; CT44; Transmembrane phosphatase with tensin homology; Tumor antigen BJ-HCC-5
Gene Name TPTE
Related Disease
Adenocarcinoma ( )
Advanced cancer ( )
Autism ( )
Megalencephaly ( )
Neoplasm ( )
UniProt ID
TPTE_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.3.48
Pfam ID
PF00520 ; PF10409 ; PF00102
Sequence
MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESPHTSEFKGAARVSPISESVL
ARLSKFEVEDAENVASYDSKIKKIVHSIVSSFAFGLFGVFLVLLDVTLILADLIFTDSKL
YIPLEYRSISLAIALFFLMDVLLRVFVERRQQYFSDLFNILDTAIIVILLLVDVVYIFFD
IKLLRNIPRWTHLLRLLRLIILLRIFHLFHQKRQLEKLIRRRVSENKRRYTRDGFDLDLT
YVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVV
RIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICS
TAKESLYYFGERRTDKTHSEKFQGVKTPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFI
IYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQF
FYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEK
MTSSDVVAGSD
Function Could be involved in signal transduction.
Tissue Specificity Exclusively expressed in testis.
Reactome Pathway
Synthesis of PIPs at the Golgi membrane (R-HSA-1660514 )

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adenocarcinoma DIS3IHTY Strong Genetic Variation [1]
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
Autism DISV4V1Z Strong Biomarker [2]
Megalencephaly DISYW5SV Strong Biomarker [2]
Neoplasm DISZKGEW Limited Genetic Variation [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Putative tyrosine-protein phosphatase TPTE (TPTE). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Putative tyrosine-protein phosphatase TPTE (TPTE). [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Folic acid DMEMBJC Approved Folic acid increases the expression of Putative tyrosine-protein phosphatase TPTE (TPTE). [5]
------------------------------------------------------------------------------------

References

1 Next-Generation Sequencing Approach to Non-Small Cell Lung Carcinoma Yields More Actionable Alterations.Arch Pathol Lab Med. 2018 Mar;142(3):353-357. doi: 10.5858/arpa.2017-0046-OA. Epub 2017 Dec 8.
2 Reciprocal Relationship between Head Size, an Autism Endophenotype, and Gene Dosage at 19p13.12 Points to AKAP8 and AKAP8L.PLoS One. 2015 Jun 15;10(6):e0129270. doi: 10.1371/journal.pone.0129270. eCollection 2015.
3 Next-generation sequencing of salivary high-grade neuroendocrine carcinomas identifies alterations in RB1 and the mTOR pathway.Exp Mol Pathol. 2014 Dec;97(3):572-8. doi: 10.1016/j.yexmp.2014.10.011. Epub 2014 Oct 29.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.