Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0LX681)

DOT Name	Ankyrin repeat domain-containing protein 23 (ANKRD23)
Synonyms	Diabetes-related ankyrin repeat protein; Muscle ankyrin repeat protein 3
Gene Name	ANKRD23
Related Disease	Non-insulin dependent diabetes ( ) Schizophrenia ( )
UniProt ID	ANR23_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00023 ; PF12796
Sequence	MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLE RFNSTRFNLDNLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAA ENQEYLIDKYLTDGGDPNAHDKLHRTALHWACLKGHSQLVNKLLVAGATVDARDLLDRTP VFWACRGGHLVILKQLLNQGARVNARDKIGSTPLHVAVRTRHPDCLEHLIECGAHLNAQD KEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVTPVQLARDWQRGIREALQAHVAH PRTRC
Function	May be involved in the energy metabolism. Could be a molecular link between myofibrillar stretch-induced signaling pathways and muscle gene expression.
Tissue Specificity	Mainly expressed in heart, skeletal muscle and brown adipose tissues.
KEGG Pathway	Cytoskeleton in muscle cells (hsa04820 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Limited	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ankyrin repeat domain-containing protein 23 (ANKRD23).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ankyrin repeat domain-containing protein 23 (ANKRD23).	[4]
------------------------------------------------------------------------------------

References

1	Molecular identification and characterization of a novel nuclear protein whose expression is up-regulated in insulin-resistant animals.J Biol Chem. 2003 Feb 7;278(6):3514-20. doi: 10.1074/jbc.M204563200. Epub 2002 Nov 26.
2	Genome-wide association study of schizophrenia in Ashkenazi Jews.Am J Med Genet B Neuropsychiatr Genet. 2015 Dec;168(8):649-59. doi: 10.1002/ajmg.b.32349. Epub 2015 Jul 21.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.