Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0NT3WJ)

• DOT Name: tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B)
• Synonyms: EC 2.1.1.-; Methyltransferase-like protein 2B
• Gene Name: METTL2B
• UniProt ID: MET2B_HUMAN
• EC Number: 2.1.1.-
• Pfam ID: PF08242
• Sequence:
  MAGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQ
  RVCQEKQVDYEINAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENK
  SEVCECRNNEDGPGLIMEEQHKCSSKSLEHKTQTPPVEENVTQKISDLEICADEFPGSSA
  TYRILEVGCGVGNTVFPILQTNNDPGLFVYCCDFSSTAIELVQTNSEYDPSRCFAFVHDL
  CDEEKSYPVPKGSLDIIILIFVLSAVVPDKMQKAINRLSRLLKPGGMVLLRDYGRYDMAQ
  LRFKKGQCLSGNFYVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRLQVNRGKQLTM
  YRVWIQCKYCKPLLSSTS
• Function: S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Thr)(UGU) and tRNA(Arg)(CCU).

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[2]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[3]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of tRNA N(3)-methylcytidine methyltransferase METTL2B (METTL2B).	[5]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [4] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [5] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.