Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0O80C9)

DOT Name CMRF35-like molecule 9 (CD300LG)
Synonyms CLM-9; CD300 antigen-like family member G; Triggering receptor expressed on myeloid cells 4; TREM-4; CD antigen CD300g
Gene Name CD300LG
Related Disease
Non-insulin dependent diabetes ( )
UniProt ID
CLM9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07686
Sequence
MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSR
CSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLI
SLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAE
APPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPR
VSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEK
EAPSQAPEGDVISMPPLHTSEEELGFSKFVSA
Function Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte.
Tissue Specificity Highly expressed in heart, skeletal muscle and placenta.
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of CMRF35-like molecule 9 (CD300LG). [2]
Permethrin DMZ0Q1G Approved Permethrin increases the expression of CMRF35-like molecule 9 (CD300LG). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of CMRF35-like molecule 9 (CD300LG). [4]
------------------------------------------------------------------------------------

References

1 Exome sequencing-driven discovery of coding polymorphisms associated with common metabolic phenotypes.Diabetologia. 2013 Feb;56(2):298-310. doi: 10.1007/s00125-012-2756-1. Epub 2012 Nov 19.
2 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.