Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0OIZH1)

DOT Name	Serpin A9 (SERPINA9)
Synonyms	Centerin; Germinal center B-cell-expressed transcript 1 protein
Gene Name	SERPINA9
Related Disease	Adult lymphoma ( ) B-cell neoplasm ( ) Burkitt lymphoma ( ) Neoplasm ( ) Pediatric lymphoma ( ) Follicular lymphoma ( ) Lymphoma ( ) Stroke ( ) B-cell lymphoma ( )
UniProt ID	SPA9_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00079
Sequence	MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLV LETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHS LTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVK KKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMM HQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQK RWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVS EEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS
Function	Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).
Tissue Specificity	Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Adult lymphoma	DISK8IZR	Definitive	Altered Expression	[1]
B-cell neoplasm	DISVY326	Definitive	Altered Expression	[2]
Burkitt lymphoma	DIS9D5XU	Definitive	Altered Expression	[1]
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Pediatric lymphoma	DIS51BK2	Definitive	Altered Expression	[1]
Follicular lymphoma	DISVEUR6	moderate	Altered Expression	[1]
Lymphoma	DISN6V4S	moderate	Altered Expression	[1]
Stroke	DISX6UHX	moderate	Genetic Variation	[3]
B-cell lymphoma	DISIH1YQ	Disputed	Biomarker	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Serpin A9 (SERPINA9).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Serpin A9 (SERPINA9).	[6]
------------------------------------------------------------------------------------

References

1	Gcet1 (centerin), a highly restricted marker for a subset of germinal center-derived lymphomas.Blood. 2008 Jan 1;111(1):351-8. doi: 10.1182/blood-2007-06-094151. Epub 2007 Sep 26.
2	Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells.Am J Pathol. 2003 Jul;163(1):135-44. doi: 10.1016/S0002-9440(10)63637-1.
3	Single nucleotide polymorphisms associated with coronary heart disease predict incident ischemic stroke in the atherosclerosis risk in communities study.Cerebrovasc Dis. 2008;26(4):420-4. doi: 10.1159/000155637. Epub 2008 Sep 18.
4	A new immunostain algorithm classifies diffuse large B-cell lymphoma into molecular subtypes with high accuracy.Clin Cancer Res. 2009 Sep 1;15(17):5494-502. doi: 10.1158/1078-0432.CCR-09-0113. Epub 2009 Aug 25.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.