Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0QQU8C)

• DOT Name: Insulin growth factor-like family member 1 (IGFL1)
• Gene Name: IGFL1
• Related Disease: Skin disease
• UniProt ID: IGFL1_HUMAN
• Pfam ID: PF14653
• Sequence:
  MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAV
  VPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
• Function: Probable ligand of the IGFLR1 cell membrane receptor.
• Tissue Specificity: Detected in ovary and spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Skin disease	DISDW8R6	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Insulin growth factor-like family member 1 (IGFL1).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Insulin growth factor-like family member 1 (IGFL1).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Insulin growth factor-like family member 1 (IGFL1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Insulin growth factor-like family member 1 (IGFL1).	[4]

References

• [1] Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1.J Biol Chem. 2011 May 27;286(21):18969-81. doi: 10.1074/jbc.M111.224626. Epub 2011 Mar 31.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Aberrantly expressed genes in HaCaT keratinocytes chronically exposed to arsenic trioxide. Biomark Insights. 2011 Feb 8;6:7-16.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.