Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0T836C)

DOT Name Uncharacterized protein C14orf119 (C14ORF119)
Gene Name C14ORF119
UniProt ID
CN119_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14969
Sequence
MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLED
LVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEF
SEPDFVAKFYQAVAATAGKD

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Uncharacterized protein C14orf119 (C14ORF119). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Uncharacterized protein C14orf119 (C14ORF119). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Uncharacterized protein C14orf119 (C14ORF119). [3]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Uncharacterized protein C14orf119 (C14ORF119). [4]
Permethrin DMZ0Q1G Approved Permethrin decreases the expression of Uncharacterized protein C14orf119 (C14ORF119). [5]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Uncharacterized protein C14orf119 (C14ORF119). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Uncharacterized protein C14orf119 (C14ORF119). [7]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Uncharacterized protein C14orf119 (C14ORF119). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
5 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
6 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
7 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.