Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0VRZA6)

DOT Name SAFB-like transcription modulator (SLTM)
Synonyms Modulator of estrogen-induced transcription
Gene Name SLTM
Related Disease
Neoplasm ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Anaplastic astrocytoma ( )
Fibrosarcoma ( )
Glioblastoma multiforme ( )
UniProt ID
SLTM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00076 ; PF02037
Sequence
MAAATGAVAASAASGQAEGKKITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEG
GDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN
DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIESQEIEAQEGED
DTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAED
DNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMN
ANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESKD
SKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
SPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSR
SSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKDEKNDNGASGQTSESI
KKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYR
RKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERL
QRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIAREREELRRQQQQLRYEQ
EKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFP
ESSAVQSSSFERRDRFVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRE
SDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKSEGSMSTDKRETRVER
PERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRD
TSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSNASPINRIVQISGNSMPRGSG
SGFKPFKGGPPRRF
Function When overexpressed, acts as a general inhibitor of transcription that eventually leads to apoptosis.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Altered Expression [1]
Adult glioblastoma DISVP4LU Strong Altered Expression [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Anaplastic astrocytoma DISSBE0K Strong Biomarker [2]
Fibrosarcoma DISWX7MU Strong Biomarker [3]
Glioblastoma multiforme DISK8246 Strong Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of SAFB-like transcription modulator (SLTM). [5]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of SAFB-like transcription modulator (SLTM). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of SAFB-like transcription modulator (SLTM). [9]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of SAFB-like transcription modulator (SLTM). [7]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of SAFB-like transcription modulator (SLTM). [6]
Celastrol DMWQIJX Preclinical Celastrol decreases the expression of SAFB-like transcription modulator (SLTM). [8]
------------------------------------------------------------------------------------

References

1 Nonclinical evaluation of the serum pharmacodynamic biomarkers HGF and shed MET following dosing with the anti-MET monovalent monoclonal antibody onartuzumab.Mol Cancer Ther. 2014 Feb;13(2):540-52. doi: 10.1158/1535-7163.MCT-13-0494. Epub 2013 Nov 20.
2 RNA-seq of 272 gliomas revealed a novel, recurrent PTPRZ1-MET fusion transcript in secondary glioblastomas.Genome Res. 2014 Nov;24(11):1765-73. doi: 10.1101/gr.165126.113. Epub 2014 Aug 18.
3 Methioninase gene therapy of human cancer cells is synergistic with recombinant methioninase treatment.Cancer Res. 2000 May 15;60(10):2696-702.
4 Increased cerebrospinal fluid soluble TREM2 concentration in Alzheimer's disease.Mol Neurodegener. 2016 Jan 12;11:3. doi: 10.1186/s13024-016-0071-x.
5 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
6 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
7 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
8 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.