Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT0YA7JZ)
DOT Name | Peptidyl-prolyl cis-trans isomerase A-like 4G (PPIAL4G) | ||||
---|---|---|---|---|---|
Synonyms | PPIase A-like 4G; EC 5.2.1.8; Peptidylprolyl cis-trans isomerase A-like 4 | ||||
Gene Name | PPIAL4G | ||||
UniProt ID | |||||
3D Structure | |||||
EC Number | |||||
Pfam ID | |||||
Sequence |
MVNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGF
MCQGGDFTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTE WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF |
||||
Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||