Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT0YA7JZ)
| DOT Name | Peptidyl-prolyl cis-trans isomerase A-like 4G (PPIAL4G) | ||||
|---|---|---|---|---|---|
| Synonyms | PPIase A-like 4G; EC 5.2.1.8; Peptidylprolyl cis-trans isomerase A-like 4 | ||||
| Gene Name | PPIAL4G | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MVNSVIFFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGF
MCQGGDFTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTE WLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF |
||||
| Function | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
