Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT1033B9)
| DOT Name | Sperm protein associated with the nucleus on the X chromosome C (SPANXC) | ||||
|---|---|---|---|---|---|
| Synonyms | Cancer/testis antigen 11.3; CT11.3; Cancer/testis-associated protein CTp11; Nuclear-associated protein SPAN-Xc; SPANX-C; SPANX family member C | ||||
| Gene Name | SPANXC | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNVK
RTSPEELVNDHARENRINPLQMEEEEFMEIMVEIPAK |
||||
| Tissue Specificity | Detected in testis, melanoma and bladder carcinoma. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
5 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Drug Response of 1 Drug(s)
|
||||||||||||||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||
References
