General Information of Drug Off-Target (DOT) (ID: OT19IXKJ)

DOT Name Keratin-associated protein 10-1 (KRTAP10-1)
Synonyms High sulfur keratin-associated protein 10.1; Keratin-associated protein 10.1; Keratin-associated protein 18-1; Keratin-associated protein 18.1
Gene Name KRTAP10-1
Related Disease
Nervous system disease ( )
UniProt ID
KR101_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13885
Sequence
MAASTMSVCSSACSDSWQVDACPESCCEPHCCALSCCAPAPCLTLVCTPVSRVSSPCCQA
ACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCLPTCSKDSSS
CCQQSSCQPTCCASSSSQQSCCVPVCCKPVCYVPTCSEDSSSCCQQSSCHPACCTSSPCQ
QACCVPVRCKPVCCKPICCVPVCSGASTSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVC
RPACCMPVSSCCAPASSCQASCCRPASCVSLLCRPACSRPAC
Function
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Tissue Specificity Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues.
Reactome Pathway
Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nervous system disease DISJ7GGT Disputed Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Keratin-associated protein 10-1 (KRTAP10-1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Keratin-associated protein 10-1 (KRTAP10-1). [3]
------------------------------------------------------------------------------------

References

1 Atlas of human diseases influenced by genetic variants with extreme allele frequency differences.Hum Genet. 2017 Jan;136(1):39-54. doi: 10.1007/s00439-016-1734-y. Epub 2016 Oct 3.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.