Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1G1F4Z)

• DOT Name: GPALPP motifs-containing protein 1 (GPALPP1)
• Synonyms: Lipopolysaccharide-specific response protein 7
• Gene Name: GPALPP1
• UniProt ID: GPAM1_HUMAN
• Pfam ID: PF12572
• Sequence:
  MARDLIGPALPPGFKARGTAEDEERDPSPVAGPALPPNYKSSSSDSSDSDEDSSSLYEEG
  NQESEEDDSGPTARKQRKNQDDDDDDDDGFFGPALPPGFKKQDDSPPRPIIGPALPPGFI
  KSTQKSDKGRDDPGQQETDSSEDEDIIGPMPAKGPVNYNVTTEFEKRAQRMKEKLTKGDD
  DSSKPIVRESWMTELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEA
  RKSSSKKDEEHILSGRDKRLAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKPQERIP
  FDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGNMFL

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of GPALPP motifs-containing protein 1 (GPALPP1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of GPALPP motifs-containing protein 1 (GPALPP1).	[2]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of GPALPP motifs-containing protein 1 (GPALPP1).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of GPALPP motifs-containing protein 1 (GPALPP1).	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of GPALPP motifs-containing protein 1 (GPALPP1).	[4]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of GPALPP motifs-containing protein 1 (GPALPP1).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.