Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1NGUYY)

DOT Name	Gamma-aminobutyric acid receptor subunit gamma-1 (GABRG1)
Synonyms	GABA(A) receptor subunit gamma-1
Gene Name	GABRG1
Related Disease	Alcohol dependence ( ) Autism ( ) Autism spectrum disorder ( ) Bipolar disorder ( ) Fanconi anemia complementation group A ( ) Fanconi anemia complementation group C ( ) Fanconi's anemia ( ) Schizophrenia ( )
UniProt ID	GBRG1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02931 ; PF02932
Sequence	MGPLKAFLFSPFLLRSQSRGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIH EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTL RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF VGLRNSTEITHTISGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN QKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFE DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
Function	GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
KEGG Pathway	Neuroactive ligand-receptor interaction (hsa04080 ) Retrograde endocan.binoid sig.ling (hsa04723 ) GABAergic sy.pse (hsa04727 ) Morphine addiction (hsa05032 ) Nicotine addiction (hsa05033 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[1]
Autism	DISV4V1Z	Strong	Biomarker	[2]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[3]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[4]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[5]
Fanconi anemia complementation group C	DISKMU3D	Strong	Biomarker	[5]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[5]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Gamma-aminobutyric acid receptor subunit gamma-1 (GABRG1).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Gamma-aminobutyric acid receptor subunit gamma-1 (GABRG1).	[7]
------------------------------------------------------------------------------------

References

1	A GABRA2 variant is associated with increased stimulation and 'high' following alcohol administration.Alcohol Alcohol. 2014 Jan-Feb;49(1):1-9. doi: 10.1093/alcalc/agt163. Epub 2013 Oct 27.
2	An inversion inv(4)(p12-p15.3) in autistic siblings implicates the 4p GABA receptor gene cluster.J Med Genet. 2006 May;43(5):429-34. doi: 10.1136/jmg.2005.039693. Epub 2006 Mar 23.
3	Rare copy number variation discovery and cross-disorder comparisons identify risk genes for ADHD.Sci Transl Med. 2011 Aug 10;3(95):95ra75. doi: 10.1126/scitranslmed.3002464.
4	GABRB2 in schizophrenia and bipolar disorder: disease association, gene expression and clinical correlations.Biochem Soc Trans. 2009 Dec;37(Pt 6):1415-8. doi: 10.1042/BST0371415.
5	Identification of cytosolic proteins that bind to the Fanconi anemia complementation group C polypeptide in vitro. Evidence for a multimeric complex.J Biol Chem. 1995 Apr 28;270(17):9876-82. doi: 10.1074/jbc.270.17.9876.
6	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.