Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1R2LZM)

• DOT Name: Beta-defensin 129 (DEFB129)
• Synonyms: Beta-defensin 29; DEFB-29; Defensin, beta 129
• Gene Name: DEFB129
• UniProt ID: DB129_HUMAN
• Sequence:
  MKLLFPIFASLMLQYQVNTEFIGLRRCLMGLGRCRDHCNVDEKEIQKCKMKKCCVGPKVV
  KLIKNYLQYGTPNVLNEDVQEMLKPAKNSSAVIQRKHILSVLPQIKSTSFFANTNFVIIP
  NATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPPPPNILPTPSLELEEA
  EEQ
• Function: Has antibacterial activity.
• Tissue Specificity: Expressed specifically in testis.
• Reactome Pathway:
  Defensins (R-HSA-1461973)
  Beta defensins (R-HSA-1461957)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Beta-defensin 129 (DEFB129).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Beta-defensin 129 (DEFB129).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Beta-defensin 129 (DEFB129).	[2]

References

• [1] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.