Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1TRKFN)

DOT Name	Carbonic anhydrase 14 (CA14)
Synonyms	EC 4.2.1.1; Carbonate dehydratase XIV; Carbonic anhydrase XIV; CA-XIV
Gene Name	CA14
UniProt ID	CAH14_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	4LU3; 5CJF
EC Number	4.2.1.1
Pfam ID	PF00194
Sequence	MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPD LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGG SEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSH LHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQ LEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVG CLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Function	Reversible hydration of carbon dioxide.
Tissue Specificity	High expression in all parts of the central nervous system and lower expression in adult liver, heart, small intestine, colon, kidney, urinary bladder and skeletal muscle.
KEGG Pathway	Nitrogen metabolism (hsa00910 ) Metabolic pathways (hsa01100 )
Reactome Pathway	Reversible hydration of carbon dioxide (R-HSA-1475029 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Carbonic anhydrase 14 (CA14).	[1]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Carbonic anhydrase 14 (CA14).	[2]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Carbonic anhydrase 14 (CA14).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Carbonic anhydrase 14 (CA14).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Carbonic anhydrase 14 (CA14).	[5]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of Carbonic anhydrase 14 (CA14).	[6]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
3	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
4	New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
5	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
6	Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.