Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT23700G)
| DOT Name | Nascent polypeptide-associated complex subunit alpha-2 (NACA2) | ||||
|---|---|---|---|---|---|
| Synonyms | Alpha-NAC-like; Hom s 2.01; Nascent polypeptide-associated complex subunit alpha-like; NAC-alpha-like | ||||
| Gene Name | NACA2 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                            MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID 
                        
                    EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV  | 
            ||||
| Function | 
                                         
                        Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
                        
                     
                                     | 
            ||||
| Tissue Specificity | Expressed specifically in testis and skeletal muscle. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| 
                     2 Disease(s) Related to This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     1 Drug(s) Affected the Gene/Protein Processing of This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||
References
