Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT28OBR2)

DOT Name	High mobility group protein B4 (HMGB4)
Gene Name	HMGB4
Related Disease	Oral lichen planus ( ) Advanced cancer ( ) Non-small-cell lung cancer ( ) Breast cancer ( ) Breast carcinoma ( )
UniProt ID	HMGB4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00505 ; PF09011
Sequence	MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKY EALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSV VQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG KRVRQS

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Oral lichen planus	DISVEAJA	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[4]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[4]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of High mobility group protein B4 (HMGB4).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of High mobility group protein B4 (HMGB4).	[6]
------------------------------------------------------------------------------------

References

1	Oral lichen planus and malignant transformation: The role of p16, Ki-67, Bub-3 and SOX4 in assessing precancerous potential.Exp Ther Med. 2018 May;15(5):4157-4166. doi: 10.3892/etm.2018.5971. Epub 2018 Mar 20.
2	SRY-related high-mobility-group box 4: Crucial regulators of the EMT in cancer.Semin Cancer Biol. 2020 Dec;67(Pt 1):114-121. doi: 10.1016/j.semcancer.2019.06.008. Epub 2019 Jun 11.
3	Increased expression of SOX4 is a biomarker for malignant status and poor prognosis in patients with non-small cell lung cancer.Mol Cell Biochem. 2015 Apr;402(1-2):75-82. doi: 10.1007/s11010-014-2315-9. Epub 2015 Jan 8.
4	High-mobility group boxes mediate cell proliferation and radiosensitivity via retinoblastoma-interaction-dependent and -independent mechanisms.Cancer Biother Radiopharm. 2012 Jun;27(5):329-35. doi: 10.1089/cbr.2012.1199. Epub 2012 Jun 1.
5	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.