Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT2LPTMI)
| DOT Name | B melanoma antigen 4 (BAGE4) | ||||
|---|---|---|---|---|---|
| Synonyms | Cancer/testis antigen 2.4; CT2.4 | ||||
| Gene Name | BAGE4 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MAAGAVFLALSAQLLQARLMKEESPVVSWWLEPEDGTAL
|
||||
| Function | Unknown. Candidate gene encoding tumor antigens. | ||||
| Tissue Specificity | Not expressed in normal tissues except in testis. Expressed in melanoma, bladder and lung carcinomas. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
7 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
