Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2OF6C3)

• DOT Name: Radial spoke head 14 homolog (RSPH14)
• Synonyms: Rhabdoid tumor deletion region protein 1
• Gene Name: RSPH14
• Related Disease: Malignant rhabdoid tumour
• UniProt ID: RSP14_HUMAN
• PDB ID: 8J07
• Pfam ID: PF13646
• Sequence:
  MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECI
  YKAMNIGCMENLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDP
  SPVCRGNLYKAYMQLVQVPRGAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQ
  EDATEALGSNVVLVLKQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLL
  KDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLELLHSPMTIARLNATKALTMLA
  EAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP
• Function: Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia.
• Tissue Specificity: Expressed in adult cerebellum, spinal cord, spleen, skeletal muscle and some/5 out of 9 rhabdoid tumors. Detected in fetal brain, lung, liver and kidney.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Malignant rhabdoid tumour	DIS46HZU	Limited	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Radial spoke head 14 homolog (RSPH14).	[2]

References

• [1] Isolation of genes from the rhabdoid tumor deletion region in chromosome band 22q11.2.Gene. 2000 Jan 4;241(1):133-41. doi: 10.1016/s0378-1119(99)00456-4.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.