Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2RXFZQ)

• DOT Name: Transcriptional adapter 2-beta (TADA2B)
• Synonyms: ADA2-like protein beta; ADA2-beta
• Gene Name: TADA2B
• UniProt ID: TAD2B_HUMAN
• Pfam ID: PF00249
• Sequence:
  MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFT
  LWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLG
  KACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQD
  AETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEK
  EKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGIT
  KMEESAEYEAARHKREKRKENKNLAGSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCS
  SLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS
• Function: Coactivates PAX5-dependent transcription together with either SMARCA4 or GCN5L2.
• Reactome Pathway:
  Ub-specific processing proteases (R-HSA-5689880)
  HATs acetylate histones (R-HSA-3214847)

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcriptional adapter 2-beta (TADA2B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcriptional adapter 2-beta (TADA2B).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transcriptional adapter 2-beta (TADA2B).	[3]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Transcriptional adapter 2-beta (TADA2B).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcriptional adapter 2-beta (TADA2B).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transcriptional adapter 2-beta (TADA2B).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Transcriptional adapter 2-beta (TADA2B).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [4] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [7] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.