Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT2VI301)
| DOT Name | Small vasohibin-binding protein (SVBP) | ||||
|---|---|---|---|---|---|
| Synonyms | Coiled coil domain-containing protein 23 | ||||
| Gene Name | SVBP | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence | 
                        MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQ MQPPGE | ||||
| Function | 
                        Enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin. This activity is critical for spindle function and accurate chromosome segregation during mitosis since microtubule detyronisation regulates mitotic spindle length and postioning. Also required to enhance the solubility and secretion of VASH1 and VASH2. Plays a role in axon and excitatory synapse formation.
                        
                     | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| 3 Disease(s) Related to This DOT 
 | ||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 4 Drug(s) Affected the Gene/Protein Processing of This DOT 
 | ||||||||||||||||||||||||||||||||||||||||
| 1 Drug(s) Affected the Post-Translational Modifications of This DOT 
 | ||||||||||||||||||||||||||||||||||||||||
References
