Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2VLMTL)

DOT Name Trem-like transcript 4 protein (TREML4)
Synonyms TLT-4; Triggering receptor expressed on myeloid cells-like protein 4
Gene Name TREML4
Related Disease
Acute coronary syndrome ( )
Autoimmune disease ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Influenza ( )
Malaria ( )
Systemic lupus erythematosus ( )
UniProt ID
TRML4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07686
Sequence
MAWGGVHTCCFHLCCCCSWPQGAVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSP
SRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIIT
VLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG
GPRFLVLVLCGLLLAKGLML
Function Positively regulates Toll-like receptor TLR7 signaling in macrophages.
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute coronary syndrome DIS7DYEW Strong Altered Expression [1]
Autoimmune disease DISORMTM Strong Biomarker [2]
Coronary atherosclerosis DISKNDYU Strong Altered Expression [1]
Coronary heart disease DIS5OIP1 Strong Biomarker [1]
Influenza DIS3PNU3 Strong Biomarker [2]
Malaria DISQ9Y50 Strong Genetic Variation [3]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Trem-like transcript 4 protein (TREML4). [4]
------------------------------------------------------------------------------------

References

1 TREML4 mRNA Expression and Polymorphisms in Blood Leukocytes are Associated with Atherosclerotic Lesion Extension in Coronary Artery Disease.Sci Rep. 2019 May 10;9(1):7229. doi: 10.1038/s41598-019-43745-y.
2 The receptor TREML4 amplifies TLR7-mediated signaling during antiviral responses and autoimmunity.Nat Immunol. 2015 May;16(5):495-504. doi: 10.1038/ni.3143. Epub 2015 Apr 6.
3 Novel genetic polymorphisms associated with severe malaria and under selective pressure in North-eastern Tanzania.PLoS Genet. 2018 Jan 30;14(1):e1007172. doi: 10.1371/journal.pgen.1007172. eCollection 2018 Jan.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.