Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3GFTFZ)

DOT Name	Potassium channel subfamily K member 16 (KCNK16)
Synonyms	2P domain potassium channel Talk-1; TWIK-related alkaline pH-activated K(+) channel 1; TALK-1
Gene Name	KCNK16
Related Disease	Non-insulin dependent diabetes ( ) Type-1/2 diabetes ( )
UniProt ID	KCNKG_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07885
Sequence	MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF PISKKGLGS
Function	Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.
Tissue Specificity	Highly expressed in pancreas. Not detectable in the other tissues tested.
Reactome Pathway	Phase 4 - resting membrane potential (R-HSA-5576886 ) TWIK-related alkaline pH activated K+ channel (TALK) (R-HSA-1299361 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[1]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Potassium channel subfamily K member 16 (KCNK16).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Potassium channel subfamily K member 16 (KCNK16).	[4]
------------------------------------------------------------------------------------

References

1	East Asian Genome-wide association study derived loci in relation to type 2 diabetes in the Han Chinese population.Acta Biochim Pol. 2019 May 30;66(2):679-686. doi: 10.18388/abp.2020_5563.
2	TALK-1 channels control cell endoplasmic reticulum Ca(2+) homeostasis.Sci Signal. 2017 Sep 19;10(497):eaan2883. doi: 10.1126/scisignal.aan2883.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.