Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3TAYTX)

• DOT Name: 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3)
• Synonyms: EC 1.14.11.-
• Gene Name: OGFOD3
• UniProt ID: OGFD3_HUMAN
• EC Number: 1.14.11.-
• Pfam ID: PF13640
• Sequence:
  MAPQRRAATKAPEGNGAAERRNRSSTKKDRAPREVQRLWQRPWLRTAGLGAGFVLTALLL
  WSSLGADDGVAEVLARRGEVVAGRFIEVPCSEDYDSHRRFEGCTPRKCGRGVTDVVITRE
  EAERIRSVAEKGLSLGGSDGGASILDLHSGALSVGKHFVNLYRYFGDKIQNIFSEEDFRL
  YREVRQKVQLTIAEAFGISASSLHLTKPTFFSRINSTEARTAHDEYWHAHVDKVTYGSFD
  YTSLLYLSNYLEDFGGGRFMFMEEGANKTVEPRAGRVSFFTSGSENLHRVEKVHWGTRYA
  ITIAFSCNPDHGIEDPAFP

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3).	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3).	[2]
Menadione	DMSJDTY	Approved	Menadione affects the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 3 (OGFOD3).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.