Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT425SIG)
| DOT Name | Leydig cell tumor 10 kDa protein homolog (C19ORF53) | ||||
|---|---|---|---|---|---|
| Gene Name | C19ORF53 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence |
MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKK
IEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS |
||||
| Function | May have a potential role in hypercalcemia of malignancy. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||
References
