Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT4GG8ED)
| DOT Name | Troponin I, slow skeletal muscle (TNNI1) | ||||
|---|---|---|---|---|---|
| Synonyms | Troponin I, slow-twitch isoform | ||||
| Gene Name | TNNI1 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSA DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA AKSPTSQ |
||||
| Function | Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. | ||||
| Tissue Specificity |
Highest levels observed in human skeletal muscle (e.g. gastrocnemious muscle), differentiated cultures of primary human muscle cells and rhabdomyosarcoma cells cultured in low serum medium. Expressed in C2 muscle cell myoblasts and myotubes.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
4 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References
