Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4NKG1S)

• DOT Name: Myb/SANT-like DNA-binding domain-containing protein 1 (MSANTD1)
• Gene Name: MSANTD1
• Related Disease:
  Huntington disease
  Schizophrenia
• UniProt ID: MSD1_HUMAN
• Pfam ID: PF13837
• Sequence:
  MVRGAGPGPSLSALSHPTGASGMAAAEGPGYLVSPQAEKHRRARNWTDAEMRGLMLVWEE
  FFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKITNMTFQYRKLKCMTDSESAPP
  DWPYYLAIDGILAKVPESCDGKLPDSQPPGPSTSQTEASLSPPAKSTPLYFPYNQCSYEG
  RFEDDRSDSSSSLLSLKFRSEERPVKKRKVQSCHLQKKQLRLLEAMVEEQRRLSRAVEET
  CREVRRVLDQQHILQVQSLQLQERMMSLLERIITKSSV

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Huntington disease	DISQPLA4	Strong	Genetic Variation	[1]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Myb/SANT-like DNA-binding domain-containing protein 1 (MSANTD1).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Myb/SANT-like DNA-binding domain-containing protein 1 (MSANTD1).	[5]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Myb/SANT-like DNA-binding domain-containing protein 1 (MSANTD1).	[4]

References

• [1] Common SNP-based haplotype analysis of the 4p16.3 Huntington disease gene region.Am J Hum Genet. 2012 Mar 9;90(3):434-44. doi: 10.1016/j.ajhg.2012.01.005. Epub 2012 Mar 1.
• [2] Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.