Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4UMXGY)

DOT Name Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B)
Synonyms TIMM23B
Gene Name TIMM23B
UniProt ID
TI23B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02466
Sequence
MEGGGGSGDKTTGVLAGFFGAGEAGYSHADLAGVPLTGMNPLCPYLNVDPRYLVQDTDEF
ILPTGANKTWGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPGNVQILNMV
TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTVSEMALDSP
FCVLLSGS
Function May participate in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. the PAM complex.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B). [1]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B). [2]
Triclosan DMZUR4N Approved Triclosan increases the expression of Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Mitochondrial import inner membrane translocase subunit Tim23B (TIMM23B). [4]
------------------------------------------------------------------------------------

References

1 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
2 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
3 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
4 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.