Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT5AOGSZ)
DOT Name | Phospholipid scramblase 2 (PLSCR2) | ||||
---|---|---|---|---|---|
Synonyms | PL scramblase 2; Ca(2+)-dependent phospholipid scramblase 2 | ||||
Gene Name | PLSCR2 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIP
VQNQPGRPEGVPWMPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIK NSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQE IEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLDE QIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFERTR |
||||
Function |
May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.; Isoform 1 has no prospholipid scramblase activity, due to the lack of a N-terminal proline-rich domain.
|
||||
Tissue Specificity | Expression of isoform 1 seems restricted to testis. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||
References