Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5GGAGZ)

DOT Name Probable inactive ribonuclease-like protein 13 (RNASE13)
Gene Name RNASE13
Related Disease
Aortic aneurysm ( )
Onchocerciasis ( )
UniProt ID
RNS13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00074
Sequence
MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMR
GKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPP
TSCYYNSTLTNQKLYLLCSRKYEADPIGIAGLYSGI
Function Does not exhibit any ribonuclease activity.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Aortic aneurysm DISQ5KRA Strong Genetic Variation [1]
Onchocerciasis DISEPYEA Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Probable inactive ribonuclease-like protein 13 (RNASE13). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Probable inactive ribonuclease-like protein 13 (RNASE13). [4]
------------------------------------------------------------------------------------

References

1 Identification of EGFLAM, SPATC1L and RNASE13 as novel susceptibility loci for aortic aneurysm in Japanese individuals by exome-wide association studies.Int J Mol Med. 2017 May;39(5):1091-1100. doi: 10.3892/ijmm.2017.2927. Epub 2017 Mar 21.
2 Epitopes of the Onchocerca volvulus RAL1 antigen, a member of the calreticulin family of proteins, recognized by sera from patients with onchocerciasis.Infect Immun. 1994 Sep;62(9):3696-704. doi: 10.1128/iai.62.9.3696-3704.1994.
3 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.