Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5SRTW1)

• DOT Name: Beta-defensin 132 (DEFB132)
• Synonyms: Beta-defensin 32; BD-32; DEFB-32; Defensin HEL-75; Defensin, beta 132
• Gene Name: DEFB132
• UniProt ID: DB132_HUMAN
• Pfam ID: PF13841
• Sequence:
  MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYS
  FLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
• Function: Has antibacterial activity.
• Reactome Pathway:
  Defensins (R-HSA-1461973)
  Beta defensins (R-HSA-1461957)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Beta-defensin 132 (DEFB132).	[1]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Beta-defensin 132 (DEFB132).	[2]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Beta-defensin 132 (DEFB132).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Beta-defensin 132 (DEFB132).	[4]

References

• [1] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [2] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [3] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.