Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5VBXC7)

• DOT Name: Basic helix-loop-helix transcription factor scleraxis (SCX)
• Synonyms: Class A basic helix-loop-helix protein 41; bHLHa41; Class A basic helix-loop-helix protein 48; bHLHa48
• Gene Name: SCX
• UniProt ID: SCX_HUMAN
• Pfam ID: PF00010
• Sequence:
  MSFATLRPAPPGRYLYPEVSPLSEDEDRGSDSSGSDEKPCRVHAARCGLQGARRRAGGRR
  AGGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLA
  SSYISHLGNVLLAGEACGDGQPCHSGPAFFHAARAGSPPPPPPPPPARDGENTQPKQICT
  FCLSNQRKLSKDRDRKTAIRS
• Function: Plays an early essential role in mesoderm formation, as well as a later role in formation of somite-derived chondrogenic lineages.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Basic helix-loop-helix transcription factor scleraxis (SCX).	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Basic helix-loop-helix transcription factor scleraxis (SCX).	[2]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Basic helix-loop-helix transcription factor scleraxis (SCX).	[3]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [3] Resveratrol modulates interleukin-1-induced phosphatidylinositol 3-kinase and nuclear factor B signaling pathways in human tenocytes. J Biol Chem. 2012 Nov 2;287(45):38050-63. doi: 10.1074/jbc.M112.377028. Epub 2012 Aug 30.