Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5WRC1N)

DOT Name	G antigen 6 (GAGE6)
Synonyms	GAGE-6; Cancer/testis antigen 4.6; CT4.6
Gene Name	GAGE6
Related Disease	Neoplasm ( )
UniProt ID	GAGE6_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF05831
Sequence	MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE DEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC
Tissue Specificity	Expressed in a variety of tumor tissues but not in normal tissues, except testis.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	G antigen 6 (GAGE6) affects the response to substance of Mitoxantrone.	[2]
------------------------------------------------------------------------------------

References

1	Binding of LINE-1 RNA to PSF transcriptionally promotes GAGE6 and regulates cell proliferation and tumor formation in vitro.Exp Ther Med. 2017 Aug;14(2):1685-1691. doi: 10.3892/etm.2017.4667. Epub 2017 Jun 26.
2	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.