General Information of Drug Off-Target (DOT) (ID: OT62PSOB)

DOT Name Platelet glycoprotein Ib alpha chain (GP1BA)
Synonyms GP-Ib alpha; GPIb-alpha; GPIbA; Glycoprotein Ibalpha; Antigen CD42b-alpha; CD antigen CD42b
Gene Name GP1BA
Related Disease
Bernard-Soulier syndrome ( )
Platelet-type von Willebrand disease ( )
Bernard-Soulier syndrome, type A2, autosomal dominant ( )
Autosomal dominant macrothrombocytopenia ( )
UniProt ID
GP1BA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1GWB; 1M0Z; 1M10; 1OOK; 1P8V; 1P9A; 1QYY; 1SQ0; 1U0N; 2BP3; 3P72; 3PMH; 4C2A; 4C2B; 4CH2; 4CH8; 4MGX; 4YR6; 6XFQ
Pfam ID
PF13855 ; PF01462
Sequence
MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV
LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP
AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT
PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS
PTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLT
TTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFW
LLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRG
SLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Function GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
KEGG Pathway
ECM-receptor interaction (hsa04512 )
Platelet activation (hsa04611 )
Neutrophil extracellular trap formation (hsa04613 )
Hematopoietic cell lineage (hsa04640 )
Reactome Pathway
GP1b-IX-V activation signalling (R-HSA-430116 )
Platelet Adhesion to exposed collagen (R-HSA-75892 )
Platelet Aggregation (Plug Formation) (R-HSA-76009 )
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459 )
Defective F9 activation (R-HSA-9673221 )
Intrinsic Pathway of Fibrin Clot Formation (R-HSA-140837 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bernard-Soulier syndrome DISLD1FU Definitive Autosomal recessive [1]
Platelet-type von Willebrand disease DISAUZDF Definitive Autosomal dominant [1]
Bernard-Soulier syndrome, type A2, autosomal dominant DIS2ETRO Strong Autosomal dominant [2]
Autosomal dominant macrothrombocytopenia DISUTMSW Supportive Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Aspirin DM672AH Approved Platelet glycoprotein Ib alpha chain (GP1BA) increases the response to substance of Aspirin. [8]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Platelet glycoprotein Ib alpha chain (GP1BA). [4]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Platelet glycoprotein Ib alpha chain (GP1BA). [5]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Platelet glycoprotein Ib alpha chain (GP1BA). [6]
ANW-32821 DMMJOZD Phase 2 ANW-32821 increases the expression of Platelet glycoprotein Ib alpha chain (GP1BA). [7]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Autosomal dominant macrothrombocytopenia in Italy is most frequently a type of heterozygous Bernard-Soulier syndrome. Blood. 2001 Mar 1;97(5):1330-5. doi: 10.1182/blood.v97.5.1330.
3 Clinical and laboratory features of 103 patients from 42 Italian families with inherited thrombocytopenia derived from the monoallelic Ala156Val mutation of GPIb (Bolzano mutation). Haematologica. 2012 Jan;97(1):82-8. doi: 10.3324/haematol.2011.050682. Epub 2011 Sep 20.
4 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 p22phox-dependent NADPH oxidase activity is required for megakaryocytic differentiation. Cell Death Differ. 2010 Dec;17(12):1842-54. doi: 10.1038/cdd.2010.67. Epub 2010 Jun 4.
7 Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
8 Variable number of tandem repeats polymorphism of platelet glycoprotein Ib alpha in Chinese people and CC genotype with aspirin sensitivity in patients with cerebral infarction. J Clin Pharm Ther. 2009 Apr;34(2):239-43. doi: 10.1111/j.1365-2710.2008.00992.x.