Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6V5TCP)

• DOT Name: Transmembrane protein 72 (TMEM72)
• Synonyms: Kidney-specific secretory protein of 37 kDa
• Gene Name: TMEM72
• Related Disease:
  Tuberculosis
  Epstein barr virus infection
• UniProt ID: TMM72_HUMAN
• Pfam ID: PF16054
• Sequence:
  MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYF
  VAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSML
  IITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPS
  SLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLD
  DGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Tuberculosis	DIS2YIMD	Disputed	Biomarker	[1]
Epstein barr virus infection	DISOO0WT	Limited	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the methylation of Transmembrane protein 72 (TMEM72).	[3]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Transmembrane protein 72 (TMEM72).	[4]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Transmembrane protein 72 (TMEM72).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transmembrane protein 72 (TMEM72).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Transmembrane protein 72 (TMEM72).	[7]

References

• [1] The study of novel DNA vaccines against tuberculosis: induction of pathogen-specific CTL in the mouse and monkey models of tuberculosis.Hum Vaccin Immunother. 2013 Mar;9(3):515-25. doi: 10.4161/hv.23229. Epub 2012 Dec 18.
• [2] Killer-specific secretory (Ksp37) gene expression in subjects with Down's syndrome.Neurol Sci. 2016 May;37(5):793-5. doi: 10.1007/s10072-016-2554-5. Epub 2016 Mar 31.
• [3] Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [6] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.