Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6VQPC1)

DOT Name	Late cornified envelope protein 4A (LCE4A)
Synonyms	Late envelope protein 8; Small proline-rich-like epidermal differentiation complex protein 4A
Gene Name	LCE4A
Related Disease	Candidemia ( ) Bladder cancer ( ) Urinary bladder cancer ( )
UniProt ID	LCE4A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14672
Sequence	MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCL SHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCCSGGGCC
Function	Precursors of the cornified envelope of the stratum corneum.
Tissue Specificity	Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta.
Reactome Pathway	Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Candidemia	DISVKFN7	Strong	Genetic Variation	[1]
Bladder cancer	DISUHNM0	moderate	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	moderate	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Late cornified envelope protein 4A (LCE4A).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Late cornified envelope protein 4A (LCE4A).	[5]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Late cornified envelope protein 4A (LCE4A).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Late cornified envelope protein 4A (LCE4A).	[6]
------------------------------------------------------------------------------------

References

1	Immunochip SNP array identifies novel genetic variants conferring susceptibility to candidaemia.Nat Commun. 2014 Sep 8;5:4675. doi: 10.1038/ncomms5675.
2	Adaptation to Extreme Environments in an Admixed Human Population from the Atacama Desert.Genome Biol Evol. 2019 Sep 1;11(9):2468-2479. doi: 10.1093/gbe/evz172.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.