Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT77Z5Y5)

DOT Name	Protein TNT (C16ORF82)
Gene Name	C16ORF82
Related Disease	Nemaline myopathy ( ) Nemaline myopathy 5 ( ) Coronary atherosclerosis ( ) Coronary heart disease ( ) Fabry disease ( ) Friedreich's ataxia ( ) Neoplasm ( ) Psoriasis ( ) Triple negative breast cancer ( ) Metastatic malignant neoplasm ( )
UniProt ID	TNT_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15765
Sequence	MSLVPGQHCSPSHTRLHLTSPITMGTEPATQNTEFSKGSLIYGVTSPQRGHSQHSEASQG PLSLDKPLQLPPIFLEGEKGESSVQNEQEGEPSLQSPSLELQSPAWPRHAGVAQEPLKVS SSYLSDTQSSESHVSSVQHPRPEEGSHASLSSGYAGDKEGSDISLVGSHRRVRLNRRLNT QAASNQTSQLGSIDPPSSLKSRLTGPAHSTKQTGGKE
Tissue Specificity	Preferentially expressed in teratocarcinoma rather than in normal testis.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Nemaline myopathy	DIS5IYLY	Definitive	Genetic Variation	[1]
Nemaline myopathy 5	DISNFIVZ	Definitive	Genetic Variation	[1]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[2]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[2]
Fabry disease	DISUUQJF	Strong	Biomarker	[3]
Friedreich's ataxia	DIS5DV35	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Psoriasis	DIS59VMN	Strong	Biomarker	[5]
Triple negative breast cancer	DISAMG6N	moderate	Genetic Variation	[6]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Biomarker	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 10 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein TNT (C16ORF82).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein TNT (C16ORF82).	[9]
------------------------------------------------------------------------------------

References

1	Truncation by Glu180 nonsense mutation results in complete loss of slow skeletal muscle troponin T in a lethal nemaline myopathy.J Biol Chem. 2003 Jul 11;278(28):26159-65. doi: 10.1074/jbc.M303469200. Epub 2003 May 5.
2	Triglyceride-Rich Lipoprotein Cholesterol and Risk of Cardiovascular Events Among Patients Receiving Statin Therapy in the TNT Trial.Circulation. 2018 Aug 21;138(8):770-781. doi: 10.1161/CIRCULATIONAHA.117.032318.
3	Value of cardiac biomarker measurement in the differential diagnosis of infiltrative cardiomyopathy patients with preserved left ventricular systolic function.J Thorac Dis. 2018 Aug;10(8):4966-4975. doi: 10.21037/jtd.2018.07.56.
4	Platinum salts in the treatment of BRCA-associated breast cancer: A true targeted chemotherapy?.Crit Rev Oncol Hematol. 2019 Mar;135:66-75. doi: 10.1016/j.critrevonc.2019.01.016. Epub 2019 Jan 30.
5	Effectiveness of Lipid-Lowering Statin Therapy in Patients With and Without Psoriasis.Clin Drug Investig. 2017 Aug;37(8):775-785. doi: 10.1007/s40261-017-0533-0.
6	Carboplatin in BRCA1/2-mutated and triple-negative breast cancer BRCAness subgroups: the TNT Trial.Nat Med. 2018 May;24(5):628-637. doi: 10.1038/s41591-018-0009-7. Epub 2018 Apr 30.
7	Factors Predicting Response, Perioperative Outcomes, and Survival Following Total Neoadjuvant Therapy for Borderline/Locally Advanced Pancreatic Cancer.Ann Surg. 2021 Feb 1;273(2):341-349. doi: 10.1097/SLA.0000000000003284.
8	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.