Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7AT26M)

DOT Name	Dynein axonemal assembly factor 6 (DNAAF6)
Synonyms	PIH1 domain-containing protein 3; Sarcoma antigen NY-SAR-97
Gene Name	DNAAF6
Related Disease	Ciliary dyskinesia, primary, 36, X-linked ( ) Primary ciliary dyskinesia ( )
UniProt ID	DAAF6_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF18201
Sequence	MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGA MGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQV GTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPE LVECTSAKAFYIPETETLEITMTMKRELDIANFF
Function	Plays a role in cytoplasmic pre-assembly of axonemal dynein.
Tissue Specificity	Expressed in testis, small intestine, prostate, adrenal gland, spleen, lung, bladder, breast and ovary. Expressed in ciliated epithelial cells .

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Ciliary dyskinesia, primary, 36, X-linked	DIS3VMKH	Strong	X-linked	[1]
Primary ciliary dyskinesia	DISOBC7V	Supportive	Autosomal dominant	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Dynein axonemal assembly factor 6 (DNAAF6).	[2]
------------------------------------------------------------------------------------

References

1	Mutations in PIH1D3 Cause X-Linked Primary Ciliary Dyskinesia with Outer and Inner Dynein Arm Defects. Am J Hum Genet. 2017 Jan 5;100(1):160-168. doi: 10.1016/j.ajhg.2016.11.019. Epub 2016 Dec 29.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.