Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT7ZCPKK)
| DOT Name | Histone H2B type W-T (H2BW1) | ||||
|---|---|---|---|---|---|
| Synonyms | H2B histone family member W testis-specific; H2B.W histone 1 | ||||
| Gene Name | H2BW1 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                        MATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFA 
                    
                TYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGHLARSTKRQTITAWETRMAV RLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK  | 
            ||||
| Function | 
                                         
                        Atypical histone H2B that can form nucleosomes structurally and dynamically indistinguishable from those containing conventional H2B. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. However, unlike conventional H2B, does not recruit chromosome condensation factors and does not participate in the assembly of mitotic chromosomes. May be important for telomere function and play a role in spermatogenesis.
                        
                     
                                     | 
            ||||
| Tissue Specificity | Testis-specific (at protein level). | ||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| 
                     3 Disease(s) Related to This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     3 Drug(s) Affected the Post-Translational Modifications of This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||
References
