Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT840164)

• DOT Name: Actin-like protein 7A (ACTL7A)
• Synonyms: Actin-like-7-alpha
• Gene Name: ACTL7A
• Related Disease:
  Riley-Day syndrome
  Bipolar disorder
  Schizoaffective disorder
  Schizophrenia
  Male infertility
• UniProt ID: ACL7A_HUMAN
• PDB ID: 2XQN
• Pfam ID: PF00022 ; PF16840
• Sequence:
  MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAA
  KERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQ
  ELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNR
  EKYAEMLFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITG
  RLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCCFVALDPIEEKKVPLSEHTIR
  YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL
  CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVLPERDSAVWTGGSILASLQGFQPLWVHRF
  EYEEHGPFFLYRRCF
• Function: May play an important role in formation and fusion of Golgi-derived vesicles during acrosome biogenesis.
• Tissue Specificity: Strongly expressed in testis. Also expressed in other tissues.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Riley-Day syndrome	DISJZHNP	Strong	Biomarker	[1]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[2]
Schizoaffective disorder	DISLBW6B	moderate	Genetic Variation	[2]
Schizophrenia	DISSRV2N	moderate	Genetic Variation	[2]
Male infertility	DISY3YZZ	Limited	Autosomal recessive	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Actin-like protein 7A (ACTL7A).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Actin-like protein 7A (ACTL7A).	[7]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Actin-like protein 7A (ACTL7A).	[5]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Actin-like protein 7A (ACTL7A).	[6]

References

• [1] Cloning, mapping, and expression of two novel actin genes, actin-like-7A (ACTL7A) and actin-like-7B (ACTL7B), from the familial dysautonomia candidate region on 9q31.Genomics. 1999 Jun 15;58(3):302-9. doi: 10.1006/geno.1999.5848.
• [2] Genome-wide association studies of smooth pursuit and antisaccade eye movements in psychotic disorders: findings from the B-SNIP study.Transl Psychiatry. 2017 Oct 24;7(10):e1249. doi: 10.1038/tp.2017.210.
• [3] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [6] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.