Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8WB3RL)

DOT Name	Hemoglobin subunit mu (HBM)
Synonyms	Hemoglobin mu chain; Mu-globin
Gene Name	HBM
Related Disease	Depression ( ) Mastocytosis ( ) Osteoporosis ( ) Skin cancer ( )
UniProt ID	HBM_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00042
Sequence	MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQ RMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQ MQAAWDKFLTGVAVVLTEKYR
Tissue Specificity	Expressed in erythroid tissues.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Depression	DIS3XJ69	Strong	Biomarker	[1]
Mastocytosis	DIS1TEE0	Strong	Biomarker	[2]
Osteoporosis	DISF2JE0	Strong	Biomarker	[3]
Skin cancer	DISTM18U	Strong	Biomarker	[4]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Hemoglobin subunit mu (HBM).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Hemoglobin subunit mu (HBM).	[7]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Hemoglobin subunit mu (HBM).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Hemoglobin subunit mu (HBM).	[8]
------------------------------------------------------------------------------------

References

1	Single Administration of HBK-15-a Triple 5-HT(1A), 5-HT(7), and 5-HT(3) Receptor Antagonist-Reverses Depressive-Like Behaviors in Mouse Model of Depression Induced by Corticosterone.Mol Neurobiol. 2018 May;55(5):3931-3945. doi: 10.1007/s12035-017-0605-4. Epub 2017 May 26.
2	Conditioned media from a cell strain derived from a patient with mastocytosis induces preferential development of cells that possess high affinity IgE receptors and the granule protease phenotype of mature cutaneous mast cells.J Biol Chem. 1995 Feb 3;270(5):2258-63. doi: 10.1074/jbc.270.5.2258.
3	A Rare Mutation in SMAD9 Associated With High Bone Mass Identifies the SMAD-Dependent BMP Signaling Pathway as a Potential Anabolic Target for Osteoporosis.J Bone Miner Res. 2020 Jan;35(1):92-105. doi: 10.1002/jbmr.3875. Epub 2019 Nov 14.
4	The Effect of Educational Intervention Based on Health Belief Model and Social Support on Promoting Skin Cancer Preventive Behaviors in a Sample of Iranian Farmers.J Cancer Educ. 2019 Apr;34(2):392-401. doi: 10.1007/s13187-017-1317-1.
5	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.