Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT92AILF)

DOT Name Nucleoredoxin-like protein 1 (NXNL1)
Synonyms Thioredoxin-like protein 6
Gene Name NXNL1
Related Disease
Blindness ( )
Retinopathy ( )
Leber congenital amaurosis ( )
Retinitis pigmentosa ( )
UniProt ID
NXNL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13905
Sequence
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVR
LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERL
PAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTEC
LRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Function
Plays an important role in retinal cone photoreceptor survival. In association with glucose transporter SLC16A1/GLUT1 and BSG, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors. May play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blindness DISTIM10 Strong Biomarker [1]
Retinopathy DISB4B0F moderate Biomarker [2]
Leber congenital amaurosis DISMGH8F Limited Unknown [3]
Retinitis pigmentosa DISCGPY8 Limited Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Nucleoredoxin-like protein 1 (NXNL1). [4]
------------------------------------------------------------------------------------

References

1 Rod-derived cone viability factor promotes cone survival by stimulating aerobic glycolysis.Cell. 2015 May 7;161(4):817-32. doi: 10.1016/j.cell.2015.03.023.
2 The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina.Hum Mol Genet. 2010 Jan 15;19(2):250-61. doi: 10.1093/hmg/ddp484. Epub 2009 Oct 20.
3 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.