Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT92BHK1)

DOT Name CPX chromosomal region candidate gene 1 protein (CPXCR1)
Synonyms Cancer/testis antigen 77; CT77
Gene Name CPXCR1
Related Disease
Cleft palate with or without ankyloglossia, X-linked ( )
UniProt ID
CPXCR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSYPTKEGSDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATSQE
DVVPQAAENSELETEIQKDQREEDLKEELLLLQTPIPRKLVSHKPLNDRSRSHSGKVEMK
ANNFPINHKTRFRLSTSWRVPFINSHEIRSMILHLLCDRYFSQAAGCQNTMWVKRKYIAC
LYHPNSFTHHERAITFRRPSRVHYYRPLTERMTSGKFCKSTDTKGKCRFRAIVRSVLFVS
QIQIESIFNIKGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG
N
Tissue Specificity Expressed in a variety of fetal tissues.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cleft palate with or without ankyloglossia, X-linked DISARMUU Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of CPX chromosomal region candidate gene 1 protein (CPXCR1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of CPX chromosomal region candidate gene 1 protein (CPXCR1). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of CPX chromosomal region candidate gene 1 protein (CPXCR1). [4]
------------------------------------------------------------------------------------

References

1 Physical and transcriptional mapping of the X-linked cleft palate and ankyloglossia (CPX) critical region.Hum Genet. 2001 Jun;108(6):537-45. doi: 10.1007/s004390100518.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.