General Information of Drug Off-Target (DOT) (ID: OT93VTU4)

DOT Name Spindlin-2A (SPIN2A)
Synonyms Protein DXF34; Spindlin-like protein 2A; SPIN-2; SPIN-2A
Gene Name SPIN2A
Related Disease
Incontinentia pigmenti ( )
UniProt ID
SPI2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02513
Sequence
MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKE
GDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHIS
DANLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDD
YKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVETKPSVYF
IKFDDDFHIYVYDLVKKS
Function May be involved in the regulation of cell cycle progression. Exhibits H3K4me3-binding activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Incontinentia pigmenti DIS0ALLE Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Triclosan DMZUR4N Approved Triclosan increases the expression of Spindlin-2A (SPIN2A). [2]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Spindlin-2A (SPIN2A). [3]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Spindlin-2A (SPIN2A). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Spindlin-2A (SPIN2A). [4]
------------------------------------------------------------------------------------

References

1 A 2-Mb YAC contig encompassing three loci (DXF34, DXS14, and DXS390) that lie between Xp11.2 translocation breakpoints associated with incontinentia pigmenti type 1.Genomics. 1994 Apr;20(3):341-6. doi: 10.1006/geno.1994.1186.
2 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
3 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.