Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT950KYC)

• DOT Name: Nucleoredoxin-like protein 2 (NXNL2)
• Synonyms: Rod-derived cone viability factor 2; RdCVF2
• Gene Name: NXNL2
• UniProt ID: NXNL2_HUMAN
• Pfam ID: PF13905
• Sequence:
  MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEAR
  RPAPFEVVFVSADGSSQEMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQ
  NGEVITNKGRKQIRERGLACFQDWVEAADIFQNFSV
• Function: May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nucleoredoxin-like protein 2 (NXNL2).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Nucleoredoxin-like protein 2 (NXNL2).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nucleoredoxin-like protein 2 (NXNL2).	[7]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[2]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[5]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[8]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Nucleoredoxin-like protein 2 (NXNL2).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [6] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
• [9] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.