Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9AB48G)

• DOT Name: Corticotropin-releasing factor-binding protein (CRHBP)
• Synonyms: CRF-BP; CRF-binding protein; Corticotropin-releasing hormone-binding protein; CRH-BP
• Gene Name: CRHBP
• UniProt ID: CRHBP_HUMAN
• Pfam ID: PF05428
• Sequence:
  MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
  LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
  EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
  FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
  GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
  LEPYELENPNGNSIGEFCLSGL
• Function: Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy.
• Reactome Pathway: Class B/2 (Secretin family receptors) (R-HSA-373080)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Corticotropin-releasing factor-binding protein (CRHBP).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Corticotropin-releasing factor-binding protein (CRHBP).	[2]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Corticotropin-releasing factor-binding protein (CRHBP).	[3]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Corticotropin-releasing factor-binding protein (CRHBP).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Corticotropin-releasing factor-binding protein (CRHBP).	[5]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [4] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.